GNAS anticorps (C-Term)

N° du produit ABIN630224

L’anticorps Lapin Polyclonal anti-GNAS a été validé pour WB. Il convient pour détecter GNAS dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour GNAS anticorps (C-Term) (ABIN630224)

Antigène: GNAS (GNAS Complex Locus (GNAS))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNAS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GNAS anticorps

Épitope: C-Term

Specificité: GNAS antibody was raised against the C terminal of GNAS

Purification: Purified

Immunogène: GNAS antibody was raised using the C terminal of GNAS corresponding to a region with amino acids YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNAS Blocking Peptide, (ABIN936058), is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNAS

Antigène: GNAS (GNAS Complex Locus (GNAS))

Autre désignation: GNAS

Sujet: This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Embryonic Body Morphogenesis