GNAS anticorps (N-Term)

N° du produit ABIN630225

Cet anticorps anti-GNAS est un anticorps Lapin Polyclonal détectant GNAS dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour GNAS anticorps (N-Term) (ABIN630225)

Antigène: GNAS (GNAS Complex Locus (GNAS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNAS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-GNAS anticorps

Épitope: N-Term

Specificité: GNAS antibody was raised against the N terminal of GNAS

Purification: Purified

Immunogène: GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNAS Blocking Peptide, (ABIN5613808), is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNAS

Antigène: GNAS (GNAS Complex Locus (GNAS))

Autre désignation: GNAS

Sujet: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Embryonic Body Morphogenesis