GNAS anticorps (N-Term)

N° du produit ABIN630225

Détail du produit anti-GNAS anticorps

Antigène: GNAS (GNAS Complex Locus (GNAS))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNAS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: GNAS antibody was raised against the N terminal of GNAS

Purification: Purified

Immunogène: GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNAS Blocking Peptide, catalog no. 33R-8471, is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNAS

Antigène: GNAS (GNAS Complex Locus (GNAS))

Autre désignation: GNAS (GNAS Produits)

Synonymes: anticorps AHO, anticorps C20orf45, anticorps GNAS1, anticorps GPSA, anticorps GSA, anticorps GSP, anticorps NESP, anticorps PHP1A, anticorps PHP1B, anticorps PHP1C, anticorps POH, anticorps GNAS, anticorps PORGSA1, anticorps G-alpha-S, anticorps 5530400H20Rik, anticorps A930027G11Rik, anticorps C130027O20Rik, anticorps Galphas, anticorps Gnas1, anticorps Gnasxl, anticorps Gsa, anticorps Nesp, anticorps Nespl, anticorps Oed-Sml, anticorps Oedsml, anticorps P1, anticorps P2, anticorps P3, anticorps G-alpha-s, anticorps gnas-a, anticorps Gnpas, anticorps Nesp55, anticorps gnal, anticorps Gnas, anticorps GNAS complex locus, anticorps guanine nucleotide-binding protein G(s) subunit alpha, anticorps GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus, anticorps GNAS complex locus S homeolog, anticorps neuroendocrine secretory protein 55-like, anticorps GNAS, anticorps LOC694289, anticorps LOC469986, anticorps Gnas, anticorps gnas.S, anticorps gnas, anticorps LOC100346323, anticorps LOC100442753, anticorps LOC100732436

Sujet: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Embryonic Body Morphogenesis