MGST2 anticorps (N-Term)

N° du produit ABIN630237

Cet anticorps anti-MGST2 est un anticorps Lapin Polyclonal détectant MGST2 dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour MGST2 anticorps (N-Term) (ABIN630237)

Antigène: MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MGST2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MGST2 anticorps

Épitope: N-Term

Specificité: MGST2 antibody was raised against the N terminal of MGST2

Purification: Purified

Immunogène: MGST2 antibody was raised using the N terminal of MGST2 corresponding to a region with amino acids MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGST2 Blocking Peptide, (ABIN5614762), is also available for use as a blocking control in assays to test for specificity of this MGST2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGST2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MGST2

Antigène: MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))

Autre désignation: MGST2

Sujet: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. MGST2 is a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4.

Poids moléculaire: 16 kDa (MW of target protein)