IGSF1 anticorps (N-Term)

N° du produit ABIN630244

Cet anticorps Lapin Polyclonal détecte spécifiquement IGSF1 dans WB et IHC. Il présente une réactivité envers Humain.

Aperçu rapide pour IGSF1 anticorps (N-Term) (ABIN630244)

Antigène: IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGSF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-IGSF1 anticorps

Épitope: N-Term

Specificité: IGSF1 antibody was raised against the N terminal of IGSF1

Purification: Purified

Immunogène: IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IGSF1 Blocking Peptide, (ABIN940207), is also available for use as a blocking control in assays to test for specificity of this IGSF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGSF1

Antigène: IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))

Autre désignation: IGSF1

Sujet: Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.

Poids moléculaire: 27 kDa (MW of target protein)