ANXA6 anticorps (C-Term)

N° du produit ABIN630245

L’anticorps Lapin Polyclonal anti-ANXA6 a été validé pour WB. Il convient pour détecter ANXA6 dans des échantillons de Chemical.

Aperçu rapide pour ANXA6 anticorps (C-Term) (ABIN630245)

Antigène: ANXA6 (Annexin A6 (ANXA6))

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANXA6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ANXA6 anticorps

Épitope: C-Term

Specificité: Annexin A6 antibody was raised against the C terminal of ANXA6

Réactivité croisée: Humain

Purification: Purified

Immunogène: Annexin A6 antibody was raised using the C terminal of ANXA6 corresponding to a region with amino acids SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A6 Blocking Peptide, (ABIN5612082), is also available for use as a blocking control in assays to test for specificity of this Annexin A6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANXA6

Antigène: ANXA6 (Annexin A6 (ANXA6))

Autre désignation: Annexin A6

Classe de substances: Chemical

Sujet: Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.

Poids moléculaire: 74 kDa (MW of target protein)