Annexin A3 anticorps (N-Term)

N° du produit ABIN630250

Cet anticorps Lapin Polyclonal détecte spécifiquement Annexin A3 dans WB et IHC. Il présente une réactivité envers Chemical.

Aperçu rapide pour Annexin A3 anticorps (N-Term) (ABIN630250)

Antigène: Annexin A3 (ANXA3)

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin A3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Annexin A3 anticorps

Épitope: N-Term

Specificité: Annexin A3 antibody was raised against the N terminal of ANXA3

Réactivité croisée: Humain

Purification: Purified

Immunogène: Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A3 Blocking Peptide, (ABIN5612079), is also available for use as a blocking control in assays to test for specificity of this Annexin A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Annexin A3

Antigène: Annexin A3 (ANXA3)

Autre désignation: Annexin A3

Classe de substances: Chemical

Sujet: The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.

Poids moléculaire: 36 kDa (MW of target protein)