GJB1 anticorps (C-Term)

N° du produit ABIN630257

Détail du produit anti-GJB1 anticorps

Antigène: GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: GJB1 antibody was raised against the C terminal of GJB1

Purification: Purified

Immunogène: GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJB1 Blocking Peptide, catalog no. 33R-3256, is also available for use as a blocking control in assays to test for specificity of this GJB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJB1

Antigène: GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))

Autre désignation: GJB1 (GJB1 Produits)

Synonymes: anticorps GJIC, anticorps cmtx, anticorps cmtx1, anticorps connexin-30, anticorps connexin32, anticorps cx30, anticorps cx32, anticorps gja1, anticorps CX32, anticorps GJB1, anticorps AI118175, anticorps Cnx32, anticorps Cx32, anticorps Gjb-1, anticorps CMTX, anticorps CMTX1, anticorps gjb1-a, anticorps gap junction protein beta 1, anticorps connexin 32, anticorps probable serine/threonine-protein kinase CST, anticorps gap junction protein, beta 1, anticorps gap junction protein beta 1 L homeolog, anticorps gjb1, anticorps CX32, anticorps LOC9303136, anticorps GJB1, anticorps Gjb1, anticorps gjb1.L

Sujet: This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization