CLDN10 anticorps (C-Term)

N° du produit ABIN630264

Détail du produit anti-CLDN10 anticorps

Antigène: CLDN10 (Claudin 10 (CLDN10))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLDN10 est non-conjugé

Application: Western Blotting (WB)

Specificité: Claudin 10 antibody was raised against the C terminal of CLDN10

Purification: Purified

Immunogène: Claudin 10 antibody was raised using the C terminal of CLDN10 corresponding to a region with amino acids MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 10 Blocking Peptide, catalog no. 33R-5765, is also available for use as a blocking control in assays to test for specificity of this Claudin 10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLDN10

Antigène: CLDN10 (Claudin 10 (CLDN10))

Autre désignation: Claudin 10 (CLDN10 Produits)

Synonymes: anticorps si:busm1-52i16.3, anticorps si:dz52i16.3, anticorps CLDN10, anticorps DKFZp469F1626, anticorps CPETRL3, anticorps OSP-L, anticorps 6720456I16Rik, anticorps Cldn10a, anticorps Cldn10b, anticorps D14Ertd728e, anticorps claudin 10a, anticorps claudin 10, anticorps cldn10a, anticorps CLDN10, anticorps Cldn10

Sujet: CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Hepatitis C