Claudin 17 anticorps (Middle Region)

N° du produit ABIN630266

L’anticorps Lapin Polyclonal anti-Claudin 17 a été validé pour WB et IHC. Il convient pour détecter Claudin 17 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour Claudin 17 anticorps (Middle Region) (ABIN630266)

Antigène: Claudin 17 (CLDN17)

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 17 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Claudin 17 anticorps

Épitope: Middle Region

Specificité: Claudin 17 antibody was raised against the middle region of CLDN17

Purification: Purified

Immunogène: Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Information d'application

Indications d'application: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 17 Blocking Peptide, (ABIN940002), is also available for use as a blocking control in assays to test for specificity of this Claudin 17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 17

Antigène: Claudin 17 (CLDN17)

Autre désignation: Claudin 17

Sujet: CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C