Claudin 17 anticorps (Middle Region)
-
- Antigène Voir toutes Claudin 17 (CLDN17) Anticorps
- Claudin 17 (CLDN17)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Claudin 17 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Claudin 17 antibody was raised against the middle region of CLDN17
- Purification
- Purified
- Immunogène
- Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
- Top Product
- Discover our top product CLDN17 Anticorps primaire
-
-
- Indications d'application
-
WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Claudin 17 Blocking Peptide, catalog no. 33R-4616, is also available for use as a blocking control in assays to test for specificity of this Claudin 17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Claudin 17 (CLDN17)
- Autre désignation
- Claudin 17 (CLDN17 Produits)
- Sujet
- CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-