GJE1 anticorps (C-Term)

N° du produit ABIN630271

Détail du produit anti-GJE1 anticorps

Antigène: GJE1 (Gap Junction Protein, epsilon 1 (GJE1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJE1 antibody was raised against the C terminal of GJE1

Purification: Purified

Immunogène: GJE1 antibody was raised using the C terminal of GJE1 corresponding to a region with amino acids KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJE1 Blocking Peptide, catalog no. 33R-4739, is also available for use as a blocking control in assays to test for specificity of this GJE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJE1

Antigène: GJE1 (Gap Junction Protein, epsilon 1 (GJE1))

Autre désignation: GJE1 (GJE1 Produits)

Synonymes: anticorps AEY12, anticorps Cx23, anticorps D230044M03Rik, anticorps Gjf1, anticorps Gsfaey12, anticorps CX23, anticorps RGD1308189, anticorps gap junction protein, epsilon 1, anticorps gap junction protein epsilon 1, anticorps Gje1, anticorps GJE1

Sujet: GJE1 is a protein component of GAP junction

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Sensory Perception of Sound