ITGBL1 anticorps
-
- Antigène Voir toutes ITGBL1 Anticorps
- ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ITGBL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR
- Top Product
- Discover our top product ITGBL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ITGBL1 Blocking Peptide, catalog no. 33R-6373, is also available for use as a blocking control in assays to test for specificity of this ITGBL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGBL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))
- Autre désignation
- ITGBL1 (ITGBL1 Produits)
- Sujet
- The function of ITGBL1 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 54 kDa (MW of target protein)
-