P-Cadherin anticorps

N° du produit ABIN630281

L’anticorps anti-P-Cadherin Polyclonal Lapin est utilisé pour la détection de P-Cadherin dans des échantillons de Humain et Souris. Il a été validé pour WB et IHC.

Aperçu rapide pour P-Cadherin anticorps (ABIN630281)

Antigène: P-Cadherin (CDH3)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P-Cadherin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-P-Cadherin anticorps

Purification: Purified

Immunogène: CDH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDH3 Blocking Peptide, (ABIN937001), is also available for use as a blocking control in assays to test for specificity of this CDH3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P-Cadherin

Antigène: P-Cadherin (CDH3)

Autre désignation: CDH3

Sujet: CDH3 is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Its gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in its gene have been associated with congential hypotrichosis with juvenile macular dystrophy.

Poids moléculaire: 91 kDa (MW of target protein)