NOV anticorps (C-Term)

N° du produit ABIN630288

Cet anticorps anti-NOV est un anticorps Lapin Polyclonal détectant NOV dans WB. Adapté pour Humain.

Aperçu rapide pour NOV anticorps (C-Term) (ABIN630288)

Antigène: NOV (Nephroblastoma Overexpressed (NOV))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOV est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NOV anticorps

Épitope: C-Term

Specificité: NOV antibody was raised against the C terminal of NOV

Purification: Purified

Immunogène: NOV antibody was raised using the C terminal of NOV corresponding to a region with amino acids KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOV Blocking Peptide, (ABIN940066), is also available for use as a blocking control in assays to test for specificity of this NOV antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOV

Antigène: NOV (Nephroblastoma Overexpressed (NOV))

Autre désignation: NOV

Sujet: As an immediate-early protein, NOV is likely to play a role in cell growth regulation.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration, Growth Factor Binding