SDCBP anticorps

N° du produit ABIN630291

Cet anticorps anti-SDCBP est un anticorps Lapin Polyclonal détectant SDCBP dans WB et IHC. Adapté pour Humain, Rat, Souris et Chien.

Aperçu rapide pour SDCBP anticorps (ABIN630291)

Antigène: SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SDCBP est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SDCBP anticorps

Purification: Purified

Immunogène: SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SDCBP Blocking Peptide, (ABIN5616022), is also available for use as a blocking control in assays to test for specificity of this SDCBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SDCBP

Antigène: SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))

Autre désignation: SDCBP

Sujet: SDCBP was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.

Poids moléculaire: 32 kDa (MW of target protein)