SDCBP anticorps

N° du produit ABIN630291

Détail du produit anti-SDCBP anticorps

Antigène: SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SDCBP est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SDCBP Blocking Peptide, catalog no. 33R-9561, is also available for use as a blocking control in assays to test for specificity of this SDCBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SDCBP

Antigène: SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))

Autre désignation: SDCBP (SDCBP Produits)

Synonymes: anticorps MDA-9, anticorps ST1, anticorps SYCL, anticorps TACIP18, anticorps Sycl, anticorps syntenin-1, anticorps mda-9, anticorps st1, anticorps sycl, anticorps tacip18, anticorps MGC81274, anticorps syntenin, anticorps wu:fc51c03, anticorps wu:fk31e01, anticorps zgc:55679, anticorps zgc:77716, anticorps sb:eu862, anticorps si:dkey-235k4.1, anticorps syndecan binding protein, anticorps syndecan binding protein L homeolog, anticorps syndecan binding protein (syntenin) 2, anticorps syndecan binding protein (syntenin), anticorps SDCBP, anticorps Sdcbp, anticorps sdcbp.L, anticorps LOC732879, anticorps sdcbp2, anticorps sdcbp

Sujet: SDCBP was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.

Poids moléculaire: 32 kDa (MW of target protein)