Occludin anticorps (N-Term)

N° du produit ABIN630294

Cet anticorps anti-Occludin est un anticorps Lapin Polyclonal détectant Occludin dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour Occludin anticorps (N-Term) (ABIN630294)

Antigène: Occludin (OCLN)

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Occludin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Occludin anticorps

Épitope: N-Term

Specificité: Occludin antibody was raised against the N terminal of OCLN

Purification: Purified

Immunogène: Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Occludin Blocking Peptide, (ABIN5615104), is also available for use as a blocking control in assays to test for specificity of this Occludin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCLN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Occludin

Antigène: Occludin (OCLN)

Autre désignation: Occludin

Sujet: OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C