Occludin anticorps (N-Term)
-
- Antigène Voir toutes Occludin (OCLN) Anticorps
- Occludin (OCLN)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Occludin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Occludin antibody was raised against the N terminal of OCLN
- Purification
- Purified
- Immunogène
- Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED
- Top Product
- Discover our top product OCLN Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Occludin Blocking Peptide, catalog no. 33R-6508, is also available for use as a blocking control in assays to test for specificity of this Occludin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCLN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Occludin (OCLN)
- Autre désignation
- Occludin (OCLN Produits)
- Synonymes
- anticorps AI503564, anticorps Ocl, anticorps ocln, anticorps oclnb, anticorps tpmt, anticorps OCLN, anticorps wu:fd23h10, anticorps wu:fi13c01, anticorps zgc:113992, anticorps zgc:56359, anticorps BLCPMG, anticorps occludin, anticorps occludin S homeolog, anticorps occludin a, anticorps Ocln, anticorps OCLN, anticorps ocln.S, anticorps ocln, anticorps oclna
- Sujet
- OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.
- Poids moléculaire
- 59 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-