TMEM104 anticorps (Middle Region)

N° du produit ABIN630297

Détail du produit anti-TMEM104 anticorps

Antigène: TMEM104 (Transmembrane Protein 104 (TMEM104))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM104 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM104 antibody was raised against the middle region of TMEM104

Purification: Purified

Immunogène: TMEM104 antibody was raised using the middle region of TMEM104 corresponding to a region with amino acids GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM104 Blocking Peptide, catalog no. 33R-3200, is also available for use as a blocking control in assays to test for specificity of this TMEM104 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM104 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM104

Antigène: TMEM104 (Transmembrane Protein 104 (TMEM104))

Autre désignation: TMEM104 (TMEM104 Produits)

Synonymes: anticorps RGD1307953, anticorps C630005D06Rik, anticorps mFLJ00021, anticorps transmembrane protein 104, anticorps CpipJ_CPIJ018706, anticorps CpipJ_CPIJ018704, anticorps TMEM104, anticorps Tmem104

Sujet: The function of TMEM104 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 35 kDa (MW of target protein)