RARRES3 anticorps
-
- Antigène Voir toutes RARRES3 Anticorps
- RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RARRES3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- RARRES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV
- Top Product
- Discover our top product RARRES3 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RARRES3 Blocking Peptide, catalog no. 33R-3082, is also available for use as a blocking control in assays to test for specificity of this RARRES3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARRES3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))
- Autre désignation
- RARRES3 (RARRES3 Produits)
- Synonymes
- anticorps HRASLS4, anticorps HRSL4, anticorps PLA1/2-3, anticorps RIG1, anticorps TIG3, anticorps MGC68773, anticorps RARRES3, anticorps retinoic acid receptor responder 3, anticorps retinoic acid receptor responder (tazarotene induced) 3 L homeolog, anticorps zgc:92249, anticorps RARRES3, anticorps rarres3.L, anticorps zgc:92249
- Sujet
- Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES3 is thought act as a tumor suppressor or growth regulator.
- Poids moléculaire
- 18 kDa (MW of target protein)
-