RARRES3 anticorps

N° du produit ABIN630298

Cet anticorps Lapin Polyclonal détecte spécifiquement RARRES3 dans WB et IHC. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour RARRES3 anticorps (ABIN630298)

Antigène: RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RARRES3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RARRES3 anticorps

Purification: Purified

Immunogène: RARRES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RARRES3 Blocking Peptide, (ABIN938468), is also available for use as a blocking control in assays to test for specificity of this RARRES3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARRES3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RARRES3

Antigène: RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))

Autre désignation: RARRES3

Sujet: Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES3 is thought act as a tumor suppressor or growth regulator.

Poids moléculaire: 18 kDa (MW of target protein)