SC4MOL anticorps (N-Term)

N° du produit ABIN630307

Détail du produit anti-SC4MOL anticorps

Antigène: SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SC4MOL est non-conjugé

Application: Western Blotting (WB)

Specificité: SC4 MOL antibody was raised against the N terminal of SC4 OL

Purification: Purified

Immunogène: SC4 MOL antibody was raised using the N terminal of SC4 OL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SC4MOL Blocking Peptide, catalog no. 33R-5780, is also available for use as a blocking control in assays to test for specificity of this SC4MOL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SC0 OL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SC4MOL

Antigène: SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))

Autre désignation: SC4MOL (MSMO1 Produits)

Synonymes: anticorps sc4mol, anticorps wu:fb59g06, anticorps wu:fb66e06, anticorps zgc:56437, anticorps DESP4, anticorps ERG25, anticorps SC4MOL, anticorps Sc4mol, anticorps 1500001G16Rik, anticorps C78600, anticorps Msmo1, anticorps methylsterol monooxygenase 1, anticorps methylsterol monoxygenase 1, anticorps msmo1, anticorps MSMO1, anticorps Msmo1

Sujet: Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.

Poids moléculaire: 35 kDa (MW of target protein)