SLC25A29 anticorps (C-Term)

N° du produit ABIN630313

Détail du produit anti-SLC25A29 anticorps

Antigène: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A29 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC25 A29 antibody was raised against the C terminal of SLC25 29

Purification: Purified

Immunogène: SLC25 A29 antibody was raised using the C terminal of SLC25 29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A29 Blocking Peptide, catalog no. 33R-1129, is also available for use as a blocking control in assays to test for specificity of this SLC25A29 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A29

Antigène: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Autre désignation: SLC25A29 (SLC25A29 Produits)

Synonymes: anticorps zgc:114094, anticorps SLC25A29, anticorps slc25a29, anticorps MGC122743, anticorps C14orf69, anticorps CACL, anticorps ORNT3, anticorps C030003J19Rik, anticorps mCACL, anticorps solute carrier family 25 member 29, anticorps solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 L homeolog, anticorps solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29, anticorps solute carrier family 25 (mitochondrial carrier, palmitoylcarnitine transporter), member 29, anticorps SLC25A29, anticorps slc25a29.L, anticorps slc25a29, anticorps Slc25a29

Sujet: SLC25A29 belongs to the mitochondrial carrier family and it may has palmitoylcarnitine transporting activity.

Poids moléculaire: 33 kDa (MW of target protein)