DHODH anticorps (N-Term)

N° du produit ABIN630322

Cet anticorps Lapin Polyclonal détecte spécifiquement DHODH dans WB. Il présente une réactivité envers Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour DHODH anticorps (N-Term) (ABIN630322)

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHODH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DHODH anticorps

Épitope: N-Term

Specificité: DHODH antibody was raised against the N terminal of DHODH

Purification: Purified

Immunogène: DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLR

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHODH Blocking Peptide, (ABIN938288), is also available for use as a blocking control in assays to test for specificity of this DHODH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHODH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHODH

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Autre désignation: DHODH

Sujet: DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus