LETM1 anticorps (Middle Region)

N° du produit ABIN630325

Détail du produit anti-LETM1 anticorps

Antigène: LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LETM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LETM1 antibody was raised against the middle region of LETM1

Purification: Purified

Immunogène: LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LETM1 Blocking Peptide, catalog no. 33R-5689, is also available for use as a blocking control in assays to test for specificity of this LETM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LETM1

Antigène: LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))

Autre désignation: LETM1 (LETM1 Produits)

Sujet: The LETM1 is a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.

Poids moléculaire: 60 kDa (MW of target protein)