SLC38A1 anticorps (Middle Region)

N° du produit ABIN630328

Détail du produit anti-SLC38A1 anticorps

Antigène: SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC38A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SLC38 A1 antibody was raised against the middle region of SLC38 1

Purification: Purified

Immunogène: SLC38 A1 antibody was raised using the middle region of SLC38 1 corresponding to a region with amino acids DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC38A1 Blocking Peptide, catalog no. 33R-2150, is also available for use as a blocking control in assays to test for specificity of this SLC38A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC38A1

Antigène: SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))

Autre désignation: SLC38A1 (SLC38A1 Produits)

Synonymes: anticorps ATA1, anticorps NAT2, anticorps SAT1, anticorps SNAT1, anticorps AA408026, anticorps AA409865, anticorps AL022800, anticorps AU015942, anticorps Ata1, anticorps GlnT, anticorps Sat1, anticorps solute carrier family 38 member 1, anticorps solute carrier family 38, member 1, anticorps SLC38A1, anticorps Slc38a1

Sujet: Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.

Poids moléculaire: 58 kDa (MW of target protein)