TMEM91 anticorps (N-Term)

N° du produit ABIN630330

Cet anticorps anti-TMEM91 est un anticorps Lapin Polyclonal détectant TMEM91 dans WB. Adapté pour Humain.

Aperçu rapide pour TMEM91 anticorps (N-Term) (ABIN630330)

Antigène: TMEM91 (Transmembrane Protein 91 (TMEM91))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM91 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM91 anticorps

Épitope: N-Term

Specificité: TMEM91 antibody was raised against the N terminal of TMEM91

Purification: Purified

Immunogène: TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM91 Blocking Peptide, (ABIN5616691), is also available for use as a blocking control in assays to test for specificity of this TMEM91 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM91 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM91

Antigène: TMEM91 (Transmembrane Protein 91 (TMEM91))

Autre désignation: TMEM91

Sujet: The function of TMEM91 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 15 kDa (MW of target protein)