Reticulon 2 anticorps (N-Term)

N° du produit ABIN630331

Détail du produit anti-Reticulon 2 anticorps

Antigène: Reticulon 2 (RTN2)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Reticulon 2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RTN2 antibody was raised against the N terminal of RTN2

Purification: Purified

Immunogène: RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RTN2 Blocking Peptide, catalog no. 33R-6064, is also available for use as a blocking control in assays to test for specificity of this RTN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Reticulon 2

Antigène: Reticulon 2 (RTN2)

Autre désignation: RTN2 (RTN2 Produits)

Synonymes: anticorps rtn2, anticorps RTN2, anticorps nsp2, anticorps nspl1, anticorps xrtn2, anticorps RTN2-A, anticorps TTpA048i08, anticorps NSP2, anticorps NSPL1, anticorps NSPLI, anticorps SPG12, anticorps RTN2-B, anticorps RTN2-C, anticorps MMS10-P, anticorps Ms10p, anticorps Nspl1, anticorps reticulon 2, anticorps reticulon-2, anticorps reticulon 2 L homeolog, anticorps reticulon 2 (Z-band associated protein), anticorps rtn2, anticorps RTN2, anticorps LOC484444, anticorps Rtn2, anticorps rtn2.L

Sujet: This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

Poids moléculaire: 51 kDa (MW of target protein)