Reticulon 2 anticorps (N-Term)
-
- Antigène Voir toutes Reticulon 2 (RTN2) Anticorps
- Reticulon 2 (RTN2)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Reticulon 2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- RTN2 antibody was raised against the N terminal of RTN2
- Purification
- Purified
- Immunogène
- RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE
- Top Product
- Discover our top product RTN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RTN2 Blocking Peptide, catalog no. 33R-6064, is also available for use as a blocking control in assays to test for specificity of this RTN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Reticulon 2 (RTN2)
- Autre désignation
- RTN2 (RTN2 Produits)
- Synonymes
- anticorps rtn2, anticorps RTN2, anticorps nsp2, anticorps nspl1, anticorps xrtn2, anticorps RTN2-A, anticorps TTpA048i08, anticorps NSP2, anticorps NSPL1, anticorps NSPLI, anticorps SPG12, anticorps RTN2-B, anticorps RTN2-C, anticorps MMS10-P, anticorps Ms10p, anticorps Nspl1, anticorps reticulon 2, anticorps reticulon-2, anticorps reticulon 2 L homeolog, anticorps reticulon 2 (Z-band associated protein), anticorps rtn2, anticorps RTN2, anticorps LOC484444, anticorps Rtn2, anticorps rtn2.L
- Sujet
- This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
- Poids moléculaire
- 51 kDa (MW of target protein)
-