Corin anticorps (C-Term)

N° du produit ABIN630332

L’anticorps Lapin Polyclonal anti-Corin a été validé pour WB. Il convient pour détecter Corin dans des échantillons de Humain.

Aperçu rapide pour Corin anticorps (C-Term) (ABIN630332)

Antigène: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Corin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Corin anticorps

Épitope: C-Term

Specificité: CORIN antibody was raised against the C terminal of CORIN

Purification: Purified

Immunogène: CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CORIN Blocking Peptide, (ABIN939203), is also available for use as a blocking control in assays to test for specificity of this CORIN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CORIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Corin

Antigène: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Autre désignation: CORIN

Sujet: CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. CORIN converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

Poids moléculaire: 74 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones