Corin anticorps (C-Term)

N° du produit ABIN630332

Détail du produit anti-Corin anticorps

Antigène: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Corin est non-conjugé

Application: Western Blotting (WB)

Specificité: CORIN antibody was raised against the C terminal of CORIN

Purification: Purified

Immunogène: CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CORIN Blocking Peptide, catalog no. 33R-3817, is also available for use as a blocking control in assays to test for specificity of this CORIN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CORIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Corin

Antigène: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Autre désignation: CORIN (CORIN Produits)

Synonymes: anticorps CORIN, anticorps CG2105, anticorps Dmel\\CG2105, anticorps SP75, anticorps LOC559109, anticorps AV273130, anticorps Lrp4, anticorps ATC2, anticorps CRN, anticorps PEE5, anticorps TMPRSS10, anticorps corin, serine peptidase, anticorps CG2105 gene product from transcript CG2105-RC, anticorps novel protein similar to H.sapiens CORIN, corin, serine peptidase (CORIN), anticorps corin, anticorps CORIN, anticorps Corin, anticorps LOC559109

Sujet: CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. CORIN converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

Poids moléculaire: 74 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones