VAMP5 anticorps

N° du produit ABIN630333

Cet anticorps anti-VAMP5 Polyclonal Lapin (ABIN630333) détecte spécifiquement VAMP5 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour VAMP5 anticorps (ABIN630333)

Antigène: VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VAMP5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-VAMP5 anticorps

Purification: Purified

Immunogène: VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VAMP5 Blocking Peptide, (ABIN939528), is also available for use as a blocking control in assays to test for specificity of this VAMP5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAMP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VAMP5

Antigène: VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))

Autre désignation: VAMP5

Sujet: Synaptobrevins/VAMPs, syntaxins, and the 25 kDa synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. VAMP5 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.

Poids moléculaire: 13 kDa (MW of target protein)