VAMP5 anticorps
-
- Antigène Voir toutes VAMP5 Anticorps
- VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VAMP5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
- Top Product
- Discover our top product VAMP5 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VAMP5 Blocking Peptide, catalog no. 33R-4142, is also available for use as a blocking control in assays to test for specificity of this VAMP5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAMP5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))
- Autre désignation
- VAMP5 (VAMP5 Produits)
- Synonymes
- anticorps AF119384, anticorps Camp, anticorps vesicle associated membrane protein 5, anticorps vesicle-associated membrane protein 5, anticorps VAMP5, anticorps vamp5, anticorps Vamp5
- Sujet
- Synaptobrevins/VAMPs, syntaxins, and the 25 kDa synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. VAMP5 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.
- Poids moléculaire
- 13 kDa (MW of target protein)
-