Pannexin 2 anticorps (N-Term)

N° du produit ABIN630334

Cet anticorps Lapin Polyclonal détecte spécifiquement Pannexin 2 dans WB et IHC. Il présente une réactivité envers Mammifères.

Aperçu rapide pour Pannexin 2 anticorps (N-Term) (ABIN630334)

Antigène: Pannexin 2 (PANX2)

Reactivité: Mammifères

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Pannexin 2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Pannexin 2 anticorps

Épitope: N-Term

Specificité: Pannexin 2 antibody was raised against the N terminal of PANX2

Réactivité croisée: Humain, Souris, Rat (Rattus), Chien, Poisson zèbre (Danio rerio)

Purification: Purified

Immunogène: Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Pannexin 2 Blocking Peptide, (ABIN939011), is also available for use as a blocking control in assays to test for specificity of this Pannexin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Pannexin 2

Antigène: Pannexin 2 (PANX2)

Autre désignation: Pannexin 2

Sujet: PANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.

Poids moléculaire: 70 kDa (MW of target protein)