SLC41A2 anticorps (N-Term)

N° du produit ABIN630335

Détail du produit anti-SLC41A2 anticorps

Antigène: SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC41A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC41 A2 antibody was raised against the N terminal of SLC41 2

Purification: Purified

Immunogène: SLC41 A2 antibody was raised using the N terminal of SLC41 2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC41A2 Blocking Peptide, catalog no. 33R-8340, is also available for use as a blocking control in assays to test for specificity of this SLC41A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC41A2

Antigène: SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))

Autre désignation: SLC41A2 (SLC41A2 Produits)

Synonymes: anticorps MGC83802, anticorps slc41a1-l1, anticorps SLC41A1-L1, anticorps A230035L05Rik, anticorps solute carrier family 41 member 2, anticorps solute carrier family 41 member 2 L homeolog, anticorps solute carrier family 41, member 2, anticorps Slc41a2, anticorps slc41a2.L, anticorps SLC41A2, anticorps slc41a2

Sujet: SLC41A2 acts as a plasma-membrane magnesium transporter.

Poids moléculaire: 53 kDa (MW of target protein)