S1PR5 anticorps (N-Term)

N° du produit ABIN630339

Cet anticorps anti-S1PR5 est un anticorps Lapin Polyclonal détectant S1PR5 dans WB et IHC. Adapté pour Humain, Souris, Rat, Chien, Drosophila melanogaster et Poisson zèbre (Danio rerio).

Aperçu rapide pour S1PR5 anticorps (N-Term) (ABIN630339)

Antigène: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Reactivité: Humain, Souris, Rat, Chien, Drosophila melanogaster, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp S1PR5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-S1PR5 anticorps

Épitope: N-Term

Specificité: EDG8 antibody was raised against the N terminal of EDG8

Purification: Purified

Immunogène: EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EDG8 Blocking Peptide, (ABIN5613303), is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDG8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur S1PR5

Antigène: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Autre désignation: EDG8

Sujet: EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.

Poids moléculaire: 16 kDa (MW of target protein)