CHIC1 anticorps (N-Term)

N° du produit ABIN630348

Cet anticorps anti-CHIC1 est un anticorps Lapin Polyclonal détectant CHIC1 dans WB. Adapté pour Humain, Souris, Rat, Poisson zèbre (Danio rerio) et Chien.

Aperçu rapide pour CHIC1 anticorps (N-Term) (ABIN630348)

Antigène: CHIC1 (Cysteine-Rich Hydrophobic Domain 1 (CHIC1))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHIC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHIC1 anticorps

Épitope: N-Term

Specificité: CHIC1 antibody was raised against the N terminal of CHIC1

Purification: Purified

Immunogène: CHIC1 antibody was raised using the N terminal of CHIC1 corresponding to a region with amino acids LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHIC1 Blocking Peptide, (ABIN5612849), is also available for use as a blocking control in assays to test for specificity of this CHIC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHIC1

Antigène: CHIC1 (Cysteine-Rich Hydrophobic Domain 1 (CHIC1))

Autre désignation: CHIC1

Sujet: The function of CHIC protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 24 kDa (MW of target protein)