UBE2J2 anticorps

N° du produit ABIN630350

Détail du produit anti-UBE2J2 anticorps

Antigène: UBE2J2 (Ubiquitin-Conjugating Enzyme E2, J2 (UBE2J2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2J2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: UBE2 J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2J2 Blocking Peptide, catalog no. 33R-3342, is also available for use as a blocking control in assays to test for specificity of this UBE2J2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2J2

Antigène: UBE2J2 (Ubiquitin-Conjugating Enzyme E2, J2 (UBE2J2))

Autre désignation: UBE2J2 (UBE2J2 Produits)

Synonymes: anticorps NCUBE-2, anticorps NCUBE2, anticorps PRO2121, anticorps 1200007B18Rik, anticorps 2400008G19Rik, anticorps 5730472G04Rik, anticorps AL022923, anticorps Ubc6, anticorps Ubc6p, anticorps zgc:162164, anticorps ubiquitin conjugating enzyme E2 J2, anticorps ubiquitin-conjugating enzyme E2J 2, anticorps ubiquitin-conjugating enzyme E2, J2, anticorps ubiquitin-conjugating enzyme E2 J2, anticorps ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast), anticorps ubiquitin conjugating enzyme E2 J2 L homeolog, anticorps UBE2J2, anticorps Ube2j2, anticorps LOC5574000, anticorps CpipJ_CPIJ008956, anticorps ube2j2, anticorps uce2, anticorps ube2j2.L, anticorps LOC100067387

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum.

Poids moléculaire: 30 kDa (MW of target protein)