SLC26A5 anticorps

N° du produit ABIN630355

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC26A5 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour SLC26A5 anticorps (ABIN630355)

Antigène: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC26A5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SLC26A5 anticorps

Purification: Purified

Immunogène: SLC26 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC26A5 Blocking Peptide, (ABIN938469), is also available for use as a blocking control in assays to test for specificity of this SLC26A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC26A5

Antigène: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Autre désignation: SLC26A5

Sujet: SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.

Poids moléculaire: 81 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Dicarboxylic Acid Transport