SLC26A5 anticorps

N° du produit ABIN630355

Détail du produit anti-SLC26A5 anticorps

Antigène: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC26A5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SLC26 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC26A5 Blocking Peptide, catalog no. 33R-3083, is also available for use as a blocking control in assays to test for specificity of this SLC26A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC26A5

Antigène: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Autre désignation: SLC26A5 (SLC26A5 Produits)

Synonymes: anticorps pres, anticorps fb73d12, anticorps fb74g12, anticorps wu:fb73d12, anticorps wu:fb74g12, anticorps DFNB61, anticorps PRES, anticorps Pres, anticorps prestin, anticorps solute carrier family 26 (anion exchanger), member 5, anticorps solute carrier family 26 member 5, anticorps solute carrier family 26, member 5, anticorps slc26a5, anticorps SLC26A5, anticorps Slc26a5

Sujet: SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.

Poids moléculaire: 81 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Dicarboxylic Acid Transport