NSDHL anticorps

N° du produit ABIN630356

L’anticorps anti-NSDHL Polyclonal Lapin est utilisé pour la détection de NSDHL dans des échantillons de Humain, Rat et Souris. Il a été validé pour WB.

Aperçu rapide pour NSDHL anticorps (ABIN630356)

Antigène: NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NSDHL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NSDHL anticorps

Purification: Purified

Immunogène: NSDHL antibody was raised using a synthetic peptide corresponding to a region with amino acids RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NSDHL Blocking Peptide, (ABIN5615064), is also available for use as a blocking control in assays to test for specificity of this NSDHL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSDHL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NSDHL

Antigène: NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))

Autre désignation: NSDHL

Sujet: NSDHL is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in NSDHL gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males.

Poids moléculaire: 42 kDa (MW of target protein)