FLJ22167 (N-Term) anticorps
-
- Antigène
- FLJ22167
-
Épitope
- N-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- FLJ22167 antibody was raised against the N terminal of FLJ22167
- Purification
- Purified
- Immunogène
- FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FLJ22167 Blocking Peptide, catalog no. 33R-1707, is also available for use as a blocking control in assays to test for specificity of this FLJ22167 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ22167 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FLJ22167
- Sujet
- The FLJ22167 protein catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. FLJ22167 acts on the non-reducing terminal GlcNAc of short carbohydrate substrates.
- Poids moléculaire
- 36 kDa (MW of target protein)
-