MCT3 anticorps

N° du produit ABIN630366

Détail du produit anti-MCT3 anticorps

Antigène: MCT3 (Monocarboxylate Transporter 3 (MCT3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCT3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SLC16 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC16A8 Blocking Peptide, catalog no. 33R-7805, is also available for use as a blocking control in assays to test for specificity of this SLC16A8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCT3

Antigène: MCT3 (Monocarboxylate Transporter 3 (MCT3))

Autre désignation: SLC16A8 (MCT3 Produits)

Synonymes: anticorps MCT3, anticorps REMP, anticorps Mct3, anticorps fb78b01, anticorps zgc:56344, anticorps wu:fb78b01, anticorps wu:fk28b01, anticorps SLC16A3, anticorps solute carrier family 16 member 8, anticorps solute carrier family 16 (monocarboxylic acid transporters), member 8, anticorps pdgfa associated protein 1a, anticorps SLC16A8, anticorps Slc16a8, anticorps pdap1a

Sujet: SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Poids moléculaire: 55 kDa (MW of target protein)