SLC19A1 anticorps

N° du produit ABIN630376

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC19A1 dans WB et IHC. Il présente une réactivité envers Humain.

Aperçu rapide pour SLC19A1 anticorps (ABIN630376)

Antigène: SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC19A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SLC19A1 anticorps

Purification: Purified

Immunogène: SLC19 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC19A1 Blocking Peptide, (ABIN5616188), is also available for use as a blocking control in assays to test for specificity of this SLC19A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC19A1

Antigène: SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))

Autre désignation: SLC19A1

Sujet: Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport