SLC19A1 anticorps

N° du produit ABIN630376

Détail du produit anti-SLC19A1 anticorps

Antigène: SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC19A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SLC19 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC19A1 Blocking Peptide, catalog no. 33R-6599, is also available for use as a blocking control in assays to test for specificity of this SLC19A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC19A1

Antigène: SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))

Autre désignation: SLC19A1 (SLC19A1 Produits)

Synonymes: anticorps A1, anticorps MHCBFB, anticorps PO-GA, anticorps RECC1, anticorps RFC, anticorps RFC140, anticorps CHMD, anticorps FOLT, anticorps IFC1, anticorps REFC, anticorps RFC1, anticorps LOC100226745, anticorps AI323572, anticorps RFC-1, anticorps MTX1, anticorps XRFC, anticorps chmd, anticorps folt, anticorps ifc1, anticorps refc, anticorps rfc1, anticorps slc19a1, anticorps replication factor C subunit 1, anticorps solute carrier family 19 member 1, anticorps folate transporter 1, anticorps solute carrier family 19 (folate transporter), member 1, anticorps solute carrier family 19 (folate transporter), member 1 L homeolog, anticorps RFC1, anticorps SLC19A1, anticorps LOC100226745, anticorps Slc19a1, anticorps slc19a1.L

Sujet: Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport