NAT2 anticorps

N° du produit ABIN630377

Détail du produit anti-NAT2 anticorps

Antigène: NAT2 (N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAT2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NAT2 Blocking Peptide, catalog no. 33R-1747, is also available for use as a blocking control in assays to test for specificity of this NAT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAT2

Antigène: NAT2 (N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2))

Autre désignation: NAT2 (NAT2 Produits)

Synonymes: anticorps AAC2, anticorps NAT-2, anticorps PNAT, anticorps AV377607, anticorps Nat2a, anticorps NAT, anticorps AT-2, anticorps AT-B/AT-II, anticorps AT-II, anticorps AT2, anticorps N-acetyltransferase 2, anticorps N-acetyltransferase 2 (arylamine N-acetyltransferase), anticorps NAT2, anticorps Nat2

Sujet: NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.

Poids moléculaire: 32 kDa (MW of target protein)