CRELD1 anticorps (C-Term)
-
- Antigène Voir toutes CRELD1 Anticorps
- CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRELD1 est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificité
- CRELD1 antibody was raised against the C terminal of CRELD1
- Purification
- Purified
- Immunogène
- CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
- Top Product
- Discover our top product CRELD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRELD1 Blocking Peptide, catalog no. 33R-9056, is also available for use as a blocking control in assays to test for specificity of this CRELD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRELD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))
- Autre désignation
- CRELD1 (CRELD1 Produits)
- Sujet
- Epidermal growth factor like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.
- Poids moléculaire
- 45 kDa (MW of target protein)
-