LAPTM4A anticorps (Middle Region)

N° du produit ABIN630387

Cet anticorps anti-LAPTM4A est un anticorps Lapin Polyclonal détectant LAPTM4A dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour LAPTM4A anticorps (Middle Region) (ABIN630387)

Antigène: LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LAPTM4A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LAPTM4A anticorps

Épitope: Middle Region

Specificité: LAPTM4 A antibody was raised against the middle region of LAPTM4

Purification: Purified

Immunogène: LAPTM4 A antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LAPTM4A Blocking Peptide, (ABIN5614415), is also available for use as a blocking control in assays to test for specificity of this LAPTM4A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LAPTM4A

Antigène: LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))

Autre désignation: LAPTM4A

Sujet: LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined, however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Poids moléculaire: 27 kDa (MW of target protein)