LAPTM4A anticorps (Middle Region)
-
- Antigène Voir toutes LAPTM4A Anticorps
- LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LAPTM4A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LAPTM4 A antibody was raised against the middle region of LAPTM4
- Purification
- Purified
- Immunogène
- LAPTM4 A antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA
- Top Product
- Discover our top product LAPTM4A Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LAPTM4A Blocking Peptide, catalog no. 33R-9682, is also available for use as a blocking control in assays to test for specificity of this LAPTM4A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))
- Autre désignation
- LAPTM4A (LAPTM4A Produits)
- Sujet
- LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined, however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.
- Poids moléculaire
- 27 kDa (MW of target protein)
-