KIAA0494 anticorps (N-Term)

N° du produit ABIN630388

Détail du produit anti-KIAA0494 anticorps

Antigène: KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIAA0494 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KIAA0494 antibody was raised against the N terminal of KIAA0494

Purification: Purified

Immunogène: KIAA0494 antibody was raised using the N terminal of KIAA0494 corresponding to a region with amino acids DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0494 Blocking Peptide, catalog no. 33R-2036, is also available for use as a blocking control in assays to test for specificity of this KIAA0494 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0494 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIAA0494

Antigène: KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))

Autre désignation: KIAA0494 (EFCAB14 Produits)

Synonymes: anticorps KIAA0494, anticorps RP11-8J9.3, anticorps 4732418C07Rik, anticorps MGC80252, anticorps DKFZp468F099, anticorps RGD1310351, anticorps EF-hand calcium binding domain 14, anticorps EF-hand calcium binding domain 14 S homeolog, anticorps EFCAB14, anticorps Efcab14, anticorps efcab14.S, anticorps efcab14

Sujet: KIAA0494 is involved in calcium ion binding.

Poids moléculaire: 55 kDa (MW of target protein)