TOR2A anticorps (N-Term)

N° du produit ABIN630394

Détail du produit anti-TOR2A anticorps

Antigène: TOR2A (Torsin Family 2, Member A (TOR2A))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TOR2A est non-conjugé

Application: Western Blotting (WB)

Specificité: TOR2 A antibody was raised against the N terminal of TOR2

Purification: Purified

Immunogène: TOR2 A antibody was raised using the N terminal of TOR2 corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TOR2A Blocking Peptide, catalog no. 33R-3388, is also available for use as a blocking control in assays to test for specificity of this TOR2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TOR2A

Antigène: TOR2A (Torsin Family 2, Member A (TOR2A))

Autre désignation: TOR2A (TOR2A Produits)

Synonymes: anticorps tor2a, anticorps TOR2A, anticorps zgc:114110, anticorps TORP1, anticorps Prosalusin, anticorps Torsin-2A, anticorps torsin family 2 member A, anticorps torsin family 2, member A L homeolog, anticorps torsin family 2, member A, anticorps TOR2A, anticorps tor2a.L, anticorps tor2a, anticorps Tor2a

Sujet: The function of TOR2A protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 36 kDa (MW of target protein)